About: Cecropin     Goto   Sponge   NotDistinct   Permalink

An Entity of Type : yago:WikicatPeptides, within Data Space : dbpedia.org associated with source document(s)
QRcode icon
http://dbpedia.org/describe/?url=http%3A%2F%2Fdbpedia.org%2Fresource%2FCecropin

Cecropins are antimicrobial peptides. They were first isolated from the hemolymph of Hyalophora cecropia, whence the term cecropin was derived. Cecropins lyse bacterial cell membranes; they also inhibit proline uptake and cause leaky membranes.

AttributesValues
rdf:type
rdfs:label
  • Cecropin (en)
  • Cekropiny (pl)
  • Цекропін (uk)
rdfs:comment
  • Cecropins are antimicrobial peptides. They were first isolated from the hemolymph of Hyalophora cecropia, whence the term cecropin was derived. Cecropins lyse bacterial cell membranes; they also inhibit proline uptake and cause leaky membranes. (en)
  • Cekropiny – peptydy antydrobnoustrojowe po raz pierwszy opisane u ćmy . Peptydy te wyizolowano również od ssaków. Są to białka: * zbudowane z 34-39 reszt aminokwasowych * posiadają dwie α-helisy. Wyróżnia się cekropiny: * cekropinę A (KWKLFKKIEKVGQNIRDGIIIKAGPAVAVVGQATQIAK) * cekropinę B (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL) * cekropinę P1 (wyizolowana z jelita świń). (pl)
name
  • Cecropin family (en)
foaf:depiction
  • http://commons.wikimedia.org/wiki/Special:FilePath/Cecropin.png
dcterms:subject
Wikipage page ID
Wikipage revision ID
Link from a Wikipage to another Wikipage
Link from a Wikipage to an external page
sameAs
TCDB
dbp:wikiPageUsesTemplate
thumbnail
PROSITE
  • PDOC00241 (en)
SCOP
caption
  • Model of Drosophila melanogaster Cecropin A (en)
InterPro
  • IPR000875 (en)
Pfam
  • PF00272 (en)
symbol
  • Cecropin (en)
has abstract
  • Cecropins are antimicrobial peptides. They were first isolated from the hemolymph of Hyalophora cecropia, whence the term cecropin was derived. Cecropins lyse bacterial cell membranes; they also inhibit proline uptake and cause leaky membranes. Cecropins constitute a main part of the innate immune system of insects. Cecropins are small proteins anywhere from 31 - 37 amino acids long and are active against both gram-positive and gram-negative bacteria. Cecropins isolated from insects other than Hyalophora cecropia (Cecropia moth) have been given various names, such as bactericidin, lepidopterin, and sarcotoxin. All of these peptides are structurally related. (en)
  • Cekropiny – peptydy antydrobnoustrojowe po raz pierwszy opisane u ćmy . Peptydy te wyizolowano również od ssaków. Są to białka: * zbudowane z 34-39 reszt aminokwasowych * posiadają dwie α-helisy. Wyróżnia się cekropiny: * cekropinę A (KWKLFKKIEKVGQNIRDGIIIKAGPAVAVVGQATQIAK) * cekropinę B (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL) * cekropinę P1 (wyizolowana z jelita świń). Cekropiny są aktywne wobec bakterii Gram-dodatnich i Gram-ujemnych. Zarówno cekropina A, jak i cekropina B wykazują właściwości cytolityczne w stosunku do kilku różnych linii komórek nowotworowych, przy czym nie powodują niszczenia prawidłowych komórek fibroblastów, limfocytów i erytrocytów. Suttman i wsp. wykazali, że cekropiny A i B wykazują dużą toksyczność względem komórek raka pęcherza moczowego z niewielkim efektem toksycznym w stosunku do komórek prawidłowych fibroblastów. Badania Madera wykazały, że skojarzenie cekropiny A z 5-fluorouracylem przynosi dodatkowy efekt cytotoksyczny przeciwko komórkom ostrej białaczki limfatycznej i może być zastosowana w terapii przeciwnowotworowej. (pl)
OPM family
OPM protein
gold:hypernym
prov:wasDerivedFrom
page length (characters) of wiki page
Symbol
  • Cecropin
foaf:isPrimaryTopicOf
is Link from a Wikipage to another Wikipage of
is Wikipage redirect of
is foaf:primaryTopic of
Faceted Search & Find service v1.17_git139 as of Feb 29 2024


Alternative Linked Data Documents: ODE     Content Formats:   [cxml] [csv]     RDF   [text] [turtle] [ld+json] [rdf+json] [rdf+xml]     ODATA   [atom+xml] [odata+json]     Microdata   [microdata+json] [html]    About   
This material is Open Knowledge   W3C Semantic Web Technology [RDF Data] Valid XHTML + RDFa
OpenLink Virtuoso version 08.03.3330 as of Mar 19 2024, on Linux (x86_64-generic-linux-glibc212), Single-Server Edition (61 GB total memory, 56 GB memory in use)
Data on this page belongs to its respective rights holders.
Virtuoso Faceted Browser Copyright © 2009-2024 OpenLink Software